Armory
Source

Leaderboard

Scored on public signals; components with none are listed as Unranked · Formula

RankScoreComponentDescriptionEvidenceLast commitInstall
401Unrankedcustomer-mcp-servermcp · ai-agentsMCP server for securely connecting LLMs to customer data, providing customer profile retrieval, semantic search of interaction history, and exact…No signals yetNo one-command install · Source
402Unrankedprofitelligence-mcp-servermcp · ai-agentsFinancial intelligence for AI agents. Give Claude access to insider trading data, SEC filings, economic indicators, and multi-signal analysis — all…No signals yetNo one-command install · Source
403Unrankedfingersmcp · ai-agentsRead-only checks on tokens, NFTs, wallets, contracts and tokenized stocks before an agent acts. Honeypot, peg, copycat, wallet risk. Deep Robinhood…No signals yetNo one-command install · Source
404Unrankedbittensormcpmcp · ai-agentsA hosted MCP server that gives AI agents live, self-custodial access to the Bittensor blockchain, enabling queries and on-chain actions via any MCP…No signals yetNo one-command install · Source
405Unrankedipython-mcpmcp · ai-agentsProvides a persistent, stateful IPython execution environment for MCP clients, allowing agents to run Python code, define functions and classes, and…No signals yetNo one-command install · Source
406Unrankedagenticsettle-verifymcp · ai-agentsFree VOP (Verified Output Protocol) verification for AI agent outputs — score any output 0-100 and get a PASS/PARTIAL/FAIL verdict. No account, no…No signals yetNo one-command install · Source
407Unrankedcvm-mcpmcp · ai-agentsMCP server that fetches Brazilian financial data from the CVM open data portal and exposes tools for LLM clients to query companies and calculate…No signals yetNo one-command install · Source
408Unrankedbasezap-mcpmcp · ai-agentsA read-only MCP server that exposes BaseZap's tipping-agent tools to any MCP client, allowing users to fetch platform info, compute USDC tip quotes…No signals yetNo one-command install · Source
409Unrankedmailsnailmcp · ai-agentsAn open-source MCP server for sending physical mail (letters, postcards, certified mail) directly from AI agents, with per-piece payment and no…No signals yetNo one-command install · Source
410Unrankedbsl-agent-mcpmcp · ai-agentsMCP server that lets AI agents operate a user-owned wallet on the Bitcoin-IPC testnet, enabling BTC deposits, cross-subnet wBTC payments, and anchored…No signals yetNo one-command install · Source
411Unrankedx402-sub-agent-mcpmcp · ai-agentsMCP server for managing x402 payment policies (rules, coupons, tiers, usage logs) conversationally via LLM and evaluating request decisions.No signals yetNo one-command install · Source
412Unrankedhivedeskmcp · ai-agentsMCP server that exposes an in-browser AI ERP (CRM, stock, invoices, HR) with role-aware agents, enabling natural language chat and…No signals yetNo one-command install · Source
413Unrankedmcp-liveopsmcp · ai-agentsAn MCP server that enables Claude to retrieve real-time cryptocurrency market data from CoinGecko and answer price queries with live, grounded…No signals yetNo one-command install · Source
414Unrankedlionbank-wealthmcp · ai-agentsMCP server that answers market and wealth-management questions using only HSBC Private Banking insights published at privatebanking.hsbc.com, via…No signals yetNo one-command install · Source
415Unrankeddeskmcp · ai-agentsProvides multi-agent equity research for US markets with provenance-backed financial data from SEC EDGAR, technicals, macro, and Alpaca paper trading…No signals yetNo one-command install · Source
416Unrankedzostaje-mcpmcp · ai-agentsMCP server for connecting a user's Zostaje account to ChatGPT and other MCP clients, exposing read-only financial data tools.No signals yetNo one-command install · Source
417Unrankedregulated-reporting-mcpmcp · ai-agentsMCP server for regulated financial reporting on Workiva, enabling agents to search, read, and write to Workiva workbooks with policy-gated mutations…No signals yetNo one-command install · Source
418Unrankedfinance-mcp-server-komcp · ai-agentsPersonal finance research and execution toolkit for LLM agents, combining DART, Telegram, and Toss securities into one MCP server.No signals yetNo one-command install · Source
419Unrankedmemoria-codigo-localmcp · ai-agentsMCP server that indexes TypeScript/React project symbols in memory, enabling agents to find definitions, references, and dependencies without reading…No signals yetNo one-command install · Source
420Unrankedreai-mcpmcp · ai-agentsMCP server for ReAI, the Norwegian cloud accounting system, enabling AI agents to read books, look up accounts and VAT codes, and perform bookkeeping…No signals yetNo one-command install · Source
421Unrankedordnet-mcp-servermcp · ai-agentsORDnet MCP Server enables AI agents to create permanent, censorship-resistant Web3 content on the Bitcoin SV blockchain using 1SatOrdinals. It…No signals yetNo one-command install · Source
422Unrankedfinancial-context-enginemcp · ai-agentsAn MCP server that exposes personal financial data — transaction ledger, portfolio holdings, live/historical market prices, and quantitative risk…No signals yetNo one-command install · Source
423Unrankedmcp-agent-cost-optimizermcp · ai-agentsEnables precise financial analysis of AI agent costs, including token pricing, multi-step run estimates, model comparison, and ROI versus human labor…No signals yetNo one-command install · Source
424Unrankedmcwmcp · ai-agentsMulti-chain wallet MCP server that enables AI agents to manage Bitcoin, Ethereum, Solana, and Tron wallets via tools for addresses, balances…No signals yetNo one-command install · Source
425Unrankedsingularity-mcp-servermcp · ai-agentsConnects Claude AI to TradingView Desktop for multi-angle market analysis using 10 specialized agents, delivering verdicts, confidence scores, and…No signals yetNo one-command install · Source
426Unrankednanoodle-mcpmcp · ai-agentsMCP server that exposes saved nanoodle graphs as callable tools for AI agents, enabling them to run multi-model media pipelines. Supports stdio and…No signals yetNo one-command install · Source
427Unrankedstableperp-mcpmcp · ai-agentsMCP server for Stableperp options markets on Solana. Enables AI agents to fetch market liquidity, wallet portfolios, and generate secure trade links…No signals yetNo one-command install · Source
428Unrankedcasperagentkitmcp · ai-agentsEnables AI agents to interact with the Casper blockchain through MCP tools for reading node state, inspecting blocks, querying global state, and…No signals yetNo one-command install · Source
429Unrankedambrook-mcp-guardrailmcp · ai-agentsDeterministic pre-flight ledger validator that treats AI agent proposed financial writes as untrusted input, validating them against ledger invariants…No signals yetNo one-command install · Source
430Unrankedmcp-fcmcp · ai-agentsMCP server exposing the financecentre MongoDB (stocks, prices, SEC financials, insider trades, 13F funds, congressional trades, macro series, news) to…No signals yetNo one-command install · Source
431Unrankedcompcode-mcpmcp · ai-agentsOfficial CompCode MCP server that treats commission plans as code, exposing tools to author plans, assign reps, set quotas, simulate commissions…No signals yetNo one-command install · Source
432Unrankedshardnestmcp · ai-agentsMCP server for self-custodial wallet infrastructure, enabling secure key generation, Shamir secret sharing, signing, and recovery without exposing…No signals yetNo one-command install · Source
433Unrankedhailab-japan-company-datamcp · ai-agentsMCP server to search Japanese companies by corporate number or name and retrieve financial, subsidy, and procurement information from gBizINFO public…No signals yetNo one-command install · Source
434Unrankedimag8-studio-style-locking-ai-image-generation-for-agentsmcp · ai-agentsDefine one master style once (lighting, mood, composition, colour) and generate unlimited matching images with different subjects. Hosted remote MCP…No signals yetNo one-command install · Source
435Unrankedtaskmarket-mcpmcp · ai-agentsMCP server that lets AI agents browse, create, and submit tasks on Taskmarket, and check wallet balances, using the official CLI for secure key…No signals yetNo one-command install · Source
436Unrankedcomprabtc-mcpmcp · ai-agentsNon-custodial Bitcoin DCA for agent treasuries on Celo: approve USDT once and an on-chain agent buys WBTC on schedule, straight back to your wallet…No signals yetNo one-command install · Source
437Unrankedtengu-firmmcp · ai-agentsProvides AI agents access to 336 real-time and historical market, quant, SEC filing, insider trading, fundamentals, and macro data tools via MCP…No signals yetNo one-command install · Source
438Unrankedtradingagents-mcpmcp · ai-agentsMCP server that exposes TradingAgents multi-agent financial research as async tasks, generating research reports and non-executive decisions for LLM…No signals yetNo one-command install · Source
439Unrankedpop-mcpmcp · ai-agentsMCP server for POP — enabling LLMs to generate, submit, and manage Italian e-invoices (FatturaPA/SdI), Peppol invoices, and PDF invoices directly from…No signals yetNo one-command install · Source
440Unrankedfinancial-signals-mcpmcp · ai-agentsProvides derived financial intelligence for AI agents, including insider activity analysis, earnings surprises, institutional moves, stock screening…No signals yetNo one-command install · Source
441Unrankedpaparam-mcpmcp · ai-agentsExposes any paparam CLI as an MCP server, automatically deriving tool definitions, resources, and prompts from the command's own schema, with…No signals yetNo one-command install · Source
442Unrankedmcp-featuresmcp · ai-agentsProvides Dev Container Features that install code intelligence (LSP) and repository knowledge search (Orama) MCP servers into any dev container…No signals yetNo one-command install · Source
443Unrankedfin-copilot-mcpmcp · ai-agentsAn enterprise-grade, deterministic multi-agent financial analytics engine that processes natural language financial queries, generates…No signals yetNo one-command install · Source
444Unrankedweclapp-mcp-servermcp · ai-agentsEnables Claude to read weclapp data such as customers, invoices, and articles via a secure MCP server.No signals yetNo one-command install · Source
445Unrankedcegid-mcpmcp · ai-agentsOpen-source MCP server that exposes Cegid APIs (accounting, third parties, documents, HR) as tools for LLM agents via the Model Context Protocol…No signals yetNo one-command install · Source
446Unrankedagent-ledgermcp · ai-agentsDouble-entry accounting ledger MCP server for autonomous agents that enables creating accounts, posting journal entries, and generating financial…No signals yetNo one-command install · Source
447Unrankedfinancecontext-mcpmcp · ai-agentsA remote MCP server that lets LLM agents reason over a user's real financial data using the user's own Supabase JWT for security, offering tools for…No signals yetNo one-command install · Source
448Unrankedcloudsealed-mcpmcp · ai-agentsMCP server providing deterministic cost anomaly detection for cloud billing and auditable architecture risk scoring, enabling AI agents to identify…No signals yetNo one-command install · Source
449Unrankedcatalora-mcpmcp · ai-agentsAn MCP server for trading agents that provides eight tools to trade under enforceable limits, local paper trading, and comprehensive risk management.No signals yetNo one-command install · Source
450Unrankedlending-mcpmcp · ai-agentsAn MCP server that allows starting an iwoca business finance application from within a ChatGPT conversation, supporting drafting, submitting, and…No signals yetNo one-command install · Source
451Unrankedvf-stock-mcpmcp · ai-agentsFastMCP server for Vietnamese stock analysis, providing 35+ tools for fetching quotes, financials, and technical indicators (144+), and generating…No signals yetNo one-command install · Source
452Unrankedrasattrading-mcpmcp · ai-agentsA Binance price-action and liquidity-focused MCP server for AI agents, offering 39 tools for market data, analysis, screening, alerts, and order…No signals yetNo one-command install · Source
453Unrankedvale-monitormcp · ai-agentsMCP server for a self-hosted Bybit dashboard providing read-only access to candles, prices, positions, balances, trading reports, and CRUD for alerts…No signals yetNo one-command install · Source
454Unrankedfinops-agentic-reconciliation-mcp-servermcp · ai-agentsThis MCP server enables autonomous finance operations, providing tools to run 3-way matching audits, fetch unmatched invoices, trigger vendor holds…No signals yetNo one-command install · Source
455Unrankedsuperagenticmcp · ai-agentsAn MCP server that lets agents claim, work on, and finish units of work in a coordinated fleet, with lease and heartbeat protection, plus tools for…No signals yetNo one-command install · Source
456Unrankedcicashmcp · ai-agentsMCP server for CIcash, a budget system that lets AI agents spend within bounded, expiring, revocable budgets. Provides tools for budget checks…No signals yetNo one-command install · Source
457Unrankedcredit-risk-intelligence-mcpmcp · ai-agentsMCP server that exposes the credit scoring model's deterministic tools (probability of default, SHAP explanations, typicality check, financial ratios)…No signals yetNo one-command install · Source
458Unrankedparentsquare-mcpmcp · ai-agentsMCP server that gives Claude read access to your ParentSquare parent account, enabling queries about school posts, calendars, messages, directory…No signals yetNo one-command install · Source
459Unrankedscantobill-mcp-servermcp · ai-agentsMCP server for ScanToBill, an AI-powered OCR platform that extracts structured JSON from invoices and business documents in Arabic and English. It…No signals yetNo one-command install · Source
460Unrankedmcp-walletmcp · ai-agentsChain-agnostic MCP wallet interface for durable AI agents, enabling autonomous creation, signing, and broadcasting of native transfers while keeping…No signals yetNo one-command install · Source
461Unrankedomni-ai-routing-enginemcp · ai-agentsEdge-deployed predictive decision engine and circuit-breaker orchestrator for AI agents. Features low-latency telemetry, automated failover routing…No signals yetNo one-command install · Source
462Unrankeddingdawg-agent-walletmcp · ai-agentsProvides MCP tools to enforce spend policies (allow, deny, step-up, allowlist) on agent wallets with an immutable audit trail.No signals yetNo one-command install · Source
463Unrankedcodeql-lsp-mcp-servermcp · ai-agentsProvides CodeQL language intelligence to AI agents via MCP, enabling completions, hover, definitions, references, diagnostics, formatting, and…No signals yetNo one-command install · Source
464Unrankedottomcp · ai-agentsEnables AI agents to operate a local financial terminal, including market data, backtesting, paper portfolio management, and news digest, through…No signals yetNo one-command install · Source
465Unrankedpayqlmcp · ai-agentsPayQL is an MCP server that lets any AI agent query The Graph and pay per query in USDC — gasless, keyless, bring-your-own-wallet.No signals yetNo one-command install · Source
466Unrankednovapay-mcpmcp · ai-agentsMCP server for NovaPay that enables AI agents to create payment links, poll payment status, manage session lifecycle, and generate merchant keys.No signals yetNo one-command install · Source
467Unrankedmcpbuddymcp · ai-agentsAn account-scoped MCP connection hub for Claude, OpenAI and Grok, enabling private MCP endpoints, OAuth sign-in, Solana wallet binding, and content…No signals yetNo one-command install · Source
468Unrankedbase-l2-agent-kitmcp · ai-agentsMCP server for Base L2 DeFi — wallets, swaps, liquidity, price feeds, flash loansNo signals yetNo one-command install · Source
469Unrankedopspilot-mcp-servermcp · ai-agentsAn AI Operations Investigation MCP server that enables LLMs to investigate order fulfillment incidents by correlating data across independent services…No signals yetNo one-command install · Source
470Unrankedxmcp-demomcp · ai-agentsA demo MCP server built with the xmcp framework, providing a structured way to define custom tools, prompts, and resources.No signals yetNo one-command install · Source
471Unrankedjunction41-mcp-servermcp · ai-agentsMCP server for the Junction41 platform, providing 125 tools for agent lifecycle, jobs, workspace, payments, bounties, and more, enabling LLMs to…No signals yetNo one-command install · Source
472Unrankedrhodium11-mcpmcp · ai-agentsMCP server for Rhodium11 that exposes 19 tools for managing projects, schedules, orders, wallet, and feedback through any MCP-compatible AI agent.No signals yetNo one-command install · Source
473Unrankedmcptestmcp · ai-agentsAn MCP server that provides AI agents with database tools for querying customer profiles and financial audit data, featuring semantic caching and…No signals yetNo one-command install · Source
474Unrankedfinance-research-agentmcp · ai-agentsAI equity-research analyst for Indian NSE/BSE markets with 28 MCP tools enabling sector screens, valuations, SWOTs, and forensic audits using Claude…No signals yetNo one-command install · Source
475Unrankedstock-trading-simulator-mcpmcp · ai-agentsEnables conversational control of a Korean stock paper trading simulator. Users can view positions, adjust strategy parameters, and run backtests…No signals yetNo one-command install · Source
476Unrankedglobal-news-intelligence-mcpmcp · ai-agentsMCP server that fetches, ranks, and summarizes global news from 28 RSS sources across 12 categories, exposing 16 tools for LLMs to query technology…No signals yetNo one-command install · Source
477Unrankedpayment-risk-exception-ai-agent-mcpmcp · ai-agentsMCP server that provides tools for retrieving transaction context and recording AI decisions or creating human reviews for payment risk exceptions…No signals yetNo one-command install · Source
478Unrankedprespecmcp · ai-agentsAn MCP server that provides curated test cases and behavior specifications for common software features, enabling AI coding agents to define…No signals yetNo one-command install · Source
479Unrankedmcp-server-dolibarrmcp · ai-agentsAn MCP server for Dolibarr ERP/CRM that lets Claude or any MCP-compatible client read and manage thirdparties, commercial proposals, contracts, and…No signals yetNo one-command install · Source
480Unrankedcommerceops-mcp-servermcp · ai-agentsCommerceOps MCP Server is an AI-native Model Context Protocol server for e-commerce operations, enabling AI agents to autonomously diagnose and…No signals yetNo one-command install · Source
481Unrankedfabtally-safemcp · ai-agentsRead-only crypto safety MCP server that helps AI agents and wallets verify token honeypot risks, decode EIP-712 signatures, scan approval risks, and…No signals yetNo one-command install · Source
482Unrankedcommerce-ops-harnessmcp · ai-agentsEnables AI agents to investigate and resolve operational exceptions across orders, payments, inventory, and fulfillment through a multi-system truth…No signals yetNo one-command install · Source
483Unrankedask-gorilladesk-gorilladesk-mcpmcp · ai-agentsRead-only MCP server that lets Claude, ChatGPT, or Cursor answer pest-business questions from your GorillaDesk account in plain English—looks up…No signals yetNo one-command install · Source
484Unrankedimprestmcp · ai-agentsMCP server that provides programmable spend limits and audit trails for AI agents, enabling them to make payments without risking the wallet.No signals yetNo one-command install · Source
485Unrankedmcp-blockchainmcp · ai-agentsAn MCP server that exposes blockchain data as native tools for AI agents, enabling read-only queries like wallet balances and token holdings on…No signals yetNo one-command install · Source
486Unrankedlonestaroracle-mcp-servermcp · ai-agents38 AI data tools for Claude and any MCP-compatible agent covering crypto, DeFi, equities, commodities, energy, real estate, government intelligence…No signals yetNo one-command install · Source
487Unrankedwdk-wallet-liquid-mcpmcp · ai-agentsEnables AI agents to interact with a Liquid network wallet, including balance checks, transaction history, and sending L-BTC or Liquid assets. Backed…No signals yetNo one-command install · Source
488Unrankedfinpay-mcp-servermcp · ai-agentsMCP server exposing a fictional payment domain as tools, resources, and prompts, enabling reasoning over transactions, payment hubs, services, and…No signals yetNo one-command install · Source
489Unrankedgh-chaelynet-chainmemorymcp · ai-agentsProvides blockchain-based persistent memory storage for AI agents on the AICHAIN network.No signals yetNo one-command install · Source
490Unrankedtijori-finance-mcpmcp · ai-agentsIndia's first MCP server for Indian equity research, enabling natural language queries on 5,000+ NSE/BSE listed companies directly from Claude.No signals yetNo one-command install · Source
491Unrankeddreamnet-trading-trappersmcp · ai-agentsEnables agents to capture and validate market research including theses, entry conditions, targets, and invalidation, and bundle them into Warper…No signals yetNo one-command install · Source
492Unrankedboc-valet-mcpmcp · ai-agentsProvides LLM agents with live access to Canadian economic and financial data (exchange rates, interest rates, inflation, etc.) through the Bank of…No signals yetNo one-command install · Source
493Unrankedfluig-mcpmcp · ai-agentsOperates a TOTVS Fluig environment via AI agents or terminal, managing datasets, forms, global events, and BPM process definitions without Fluig…No signals yetNo one-command install · Source
494Unrankedworldmodel-mcpmcp · ai-agentsProvides an external, validated state database for LLM agents to manage long-horizon tasks, with tools for defining schemas, invariants, actions…No signals yetNo one-command install · Source
495Unrankedagentic-financial-advisormcp · ai-agentsExposes portfolio allocation, concentration risk, retirement projections, RAG document search, and a full multi-agent financial advisor query as MCP…No signals yetNo one-command install · Source
496Unrankedx402farm-mcpmcp · ai-agentsMCP server that provides AI agents with pay-per-call access to a suite of tools (honeypot check, token market, DeFi yields, etc.) via USDC on Base…No signals yetNo one-command install · Source
497Unrankedx402engine-mcpmcp · ai-agentsMCP server providing AI agents access to 38 pay-per-call APIs (LLM, image, code, audio, crypto, web, IPFS) via HTTP 402 micropayments in USDC/USDm.No signals yetNo one-command install · Source
498Unrankedcomputetoaimcp · ai-agentsA simulation engine for retirement planning, accessible via an MCP server that allows AI agents to create financial plans, manage income, expenses…No signals yetNo one-command install · Source
499Unrankedfinance-agentmcp · ai-agentsPersonal finance MCP server that integrates Plaid bank data with local SQLite memory for conversational budgeting, goal tracking, and transaction…No signals yetNo one-command install · Source
500Unrankedoanda-mcpmcp · ai-agentsEnables read-only access to OANDA v20 forex trading data, including price quotes, candlestick history, account summaries, positions, and transactions…No signals yetNo one-command install · Source

Score colour shows how many signals stand behind it, never how good it is: amber, three or more; dimmer amber, two; grey, one. The Evidence column names them.

Stars, forks and last commit are as GitHub reported them when Armory last read each repository: for most, or later. A repository may have changed since.

Leaderboard · Armory